PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462926490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 494aa    MW: 54400.6 Da    PI: 7.0711
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462926490genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.74.9e-142142773397
                -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3  33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                ++t    +++g+ Wev++   + +++  l+ GWk+F+++n+L+ gD ++F+l+g+++ +++v+v+
  462926490 214 GMTTLTLQRNGKNWEVQCV-GRVGETKRLQCGWKQFADDNDLQLGDLCLFELVGNKKHTMNVHVI 277
                344445667*********4.44444578***************************9999**9986 PP

2B347.53.3e-15367453797
                .-HHHHTT-EE--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3   7 psdvlksgrlvlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                +s +++ + l l++++a+e+   g      ktltl +++g+ Wev +  + +     l+ GWk+F+++n+L+ gD ++F+l+g+++ +++v+ f
  462926490 367 SSVSGEPCTLDLSREYADEYlplG-----MKTLTL-QRQGKNWEVHCVGWAGE-FKRLQHGWKQFADDNDLQLGDLCLFELVGNKKHTMNVHEF 453
                23344559************5433.....336665.56*********666664.568***************************9999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.5E-16177277IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-15177277IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0014186280IPR003340B3 DNA binding domain
CDDcd100171.31E-12205278No hitNo description
PfamPF023623.7E-12207277IPR003340B3 DNA binding domain
PROSITE profilePS5086311.265217280IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-20352455IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-19353455IPR015300DNA-binding pseudobarrel domain
CDDcd100173.07E-16358454No hitNo description
SMARTSM010194.9E-11360456IPR003340B3 DNA binding domain
PROSITE profilePS5086312.153361456IPR003340B3 DNA binding domain
PfamPF023625.7E-13364454IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
SPFPYQATTA QRRLWRISRG AWPSEGTFLQ ASPAGRCTGL ALSPFSLVFS GLLSFCRRPS  60
PLPNRRRRLI PLPTAPPPPN PQSANAVTIG APPITRAVDG GRSPAHVHQN LQRRAALALM  120
APALAHTNGD GALHPSGHVS SSEDDVEAHS TPGYILESGT QLTDAQKKEM EVKVQSIHSA  180
IPLFGCIIKG RRVFGEPFSL DLSWEYADEY LPLGMTTLTL QRNGKNWEVQ CVGRVGETKR  240
LQCGWKQFAD DNDLQLGDLC LFELVGNKKH TMNVHVIPMK FPRSETEGCK QRDSSGQRVE  300
VVNISSLPSS PLGHVSAAED DTEAHFVPSY ILERGIELTD AQKKEMEVKV RSIHSAIPLF  360
GCIMKSSSVS GEPCTLDLSR EYADEYLPLG MKTLTLQRQG KNWEVHCVGW AGEFKRLQHG  420
WKQFADDNDL QLGDLCLFEL VGNKKHTMNV HEFNADSAYR TTQLNEETLA KFSNLETSAS  480
TSLVGSNAFS ATEL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29012985
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-10B3 family protein